PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016446375.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 421aa    MW: 48369.9 Da    PI: 4.9015
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016446375.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.43.7e-18858151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+ie+ ++rqvtfskRr  ++KKAeE+ v Cd++v  + fs++g++  ++s
  XP_016446375.1  8 KKIEEITKRQVTFSKRRSSLIKKAEEIAVCCDVDVFFVAFSPSGRISKFCS 58
                    689*******************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.1E-21159IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.965160IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-16222IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-23386IPR002100Transcription factor, MADS-box
PfamPF003193.6E-18956IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-162237IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-163758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MGRKIEMKKI EEITKRQVTF SKRRSSLIKK AEEIAVCCDV DVFFVAFSPS GRISKFCSQK  60
SIEDMIHRYI NLPVERRLTH IADVQEKVEK LRHLNHIKGD VSKIHFLEKQ IENLELQIKK  120
STLEMQILDA NIRDYEPGVD QEPSLHQLYW CERNLQQSLQ KVMARKMNFD QMELEKQGKM  180
DTIPFQFAAQ ETDPQQLDTW INPYSASIQG NIFQFQDLTD RGKRVAGNSS NYAYNVPFAS  240
SSQCGNISFP QIQNSSPYIS AQSEQQNMVV DVQQNPTQAF GQSEAQVTFG ESSSSSIMNF  300
WNNLCNSTRP ISGPLSTMST QLNNSSQLEL DYPHTNWNTL QYPSNINVSS HNNNHIIQNN  360
DDYSSVQSDA RGLNGCSYAL EANIMENNQY FVERTQENDS WEWDDTVLNE TFSVENFSIL  420
D
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016446375.10.0PREDICTED: agamous-like MADS-box protein AGL8 homolog
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37851219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77950.22e-16AGAMOUS-like 67